PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC546_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 263aa    MW: 29291.3 Da    PI: 6.0384
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC546_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.95.5e-2197157257
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                r+R+t+t+ ql++Le+ F + + +ps++++++++++l    +++e++V++WFqNrRa+ k+
  RrC546_p1  97 RQRWTPTPVQLQILERIFDQgTGTPSKQKIKDITEELsqhgQISEQNVYNWFQNRRARSKR 157
                89*****************99**************************************97 PP

2Wus_type_Homeobox103.51.4e-3396159265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ar+RWtPtp Q++iLe+++++G+ tP+k++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
          RrC546_p1  96 ARQRWTPTPVQLQILERIFDQGTGTPSKQKIKDITEELSQHGQISEQNVYNWFQNRRARSKRKQ 159
                        789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007114.93393158IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.5E-1793160IPR009057Homeodomain-like
SMARTSM003894.3E-1495162IPR001356Homeobox domain
SuperFamilySSF466891.07E-1796159IPR009057Homeodomain-like
CDDcd000864.08E-1397159No hitNo description
PfamPF000468.0E-1997157IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MMEWDNNQQQ QPNNHNSSNL QGIDVSGGGG SSSGGMYVKV MTDEQLETLR KQIAIYATIC  60
ERLVEMHKTL TSHQDLAGVR LGGLYADPTI GHKMTARQRW TPTPVQLQIL ERIFDQGTGT  120
PSKQKIKDIT EELSQHGQIS EQNVYNWFQN RRARSKRKQH GGGVGSSNNN NNNGESEVET  180
ETETLNNGKR KIPESLRVLP DGNNAIGTTS TSPRPEDLCF QSPEMSSDLH FLSNPRDDHL  240
VGKMGLSESY SLYDHVEDYG MSG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150158RRARSKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00669PBMTransfer from GRMZM2G038252Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0482681e-125AY048268.1 Arabidopsis thaliana AT4g35550/F8D20_60 mRNA, complete cds.
GenBankAY2514041e-125AY251404.1 Arabidopsis thaliana WOX13 protein mRNA, complete cds.
GenBankBT0005381e-125BT000538.1 Arabidopsis thaliana homeodomain - like protein (At4g35550/F8D20_60) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013645925.11e-160PREDICTED: WUSCHEL-related homeobox 13-like
SwissprotO817881e-136WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLA0A078C2501e-147A0A078C250_BRANA; BnaC01g03050D protein
TrEMBLA0A0D3A1R11e-147A0A0D3A1R1_BRAOL; Uncharacterized protein
STRINGBra011623.1-P1e-142(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46202851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.11e-119WUSCHEL related homeobox 13